RBCK1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88301
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Western Blot
Cited:
Western Blot, Immunoblotting, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 30209176). Expected reactivity in Rat (88%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RBCK1 Antibody - BSA Free
Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -
Expression of RNF31 in HCC cell lines and evaluation of RNF31 knockdown. (a) The mRNA level of RNF31 was evaluated in the HepG2, Hep3B, PLC, Huh7, HLE, and HLF cell lines by qPCR. mRNA level of RNF31 in Huh7 cells was used as reference. (b) The protein expression levels of RNF31, RBCK1, and SHARPIN were evaluated by Western blotting. (c) The effect of RNF31 knockdown was evaluated using Western blotting for HepG2, Hep3B, and PLC cells transfected with control (siCont) and RNF31-specific siRNAs (siRNA1-3). For quantification, normalized RNF31/b-actin level in parental cells was used as reference. d. The effect of RNF31 knockdown was evaluated using qPCRs. mRNA level of RNF31/GAPDH in control cells was used as reference. *P < 0.05; ns, non-specific; n.s., not significant; siCont, control siRNA. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -
Inhibition of RNF31 with HOIPIN-8 decreases proliferation, invasion, and NF-kappa B activation in HCC cell lines. (a) Cell proliferation was evaluated in HepG2 and Hep3B cells treated with 100 uM HOIPIN-8. (b) Invasion was evaluated in HepG2 and Hep3B cells in the presence of 10 or 30 uM HOIPIN-8. Representative images of invading cells are shown in the right panel. Cell nuclei are stained in purple. (c) Expression of NF-kappa B target genes in HepG2 and Hep3B cells was evaluated by qPCR. Cells were pretreated with 30 uM HOIPIN-8 for 1 h, followed by stimulation with 10 ng/mL TNF-alpha for 2 h. (d) Phosphorylation of NF-kappa B signaling factors upon TNF-alpha stimulation was evaluated in HepG2 cells with or without 30 uM HOIPIN-8. Cell lysates were immunoblotted by the indicated antibodies. (e) Effect of HOIPIN-8 on TNF-alpha + CHX-mediated apoptosis in HepG2 and Hep3B cells. Cells were pre-treated with HOIPIN-8 for 1 h and then stimulated with 40 ng/mL TNF-alpha and 20 ug/mL CHX for 0, 4, and 8 h, and cell lysates were immunoblotted by the indicated antibodies. *P < 0.05; n.s., not significant; Cas-3, caspase-3; cl-Cas-3, cleaved caspase-3; CHX, cycloheximide. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -
RNF31 knockdown inhibits TNF-alpha -induced NF-kappa B activation in HCC cell lines. (a) NF-kappa B activity was evaluated in HepG2 and Hep3B cells transfected with RNF31 siRNAs using a dual luciferase assay. Cells were treated with TNF-alpha at 10 ng/mL for 6 h. (b) Evaluation of phosphorylation of NF-kappa B signaling factors induced by TNF-alpha in HepG2 cells after RNF31 knockdown. *P < 0.05; n.s., not significant; siCont, control siRNA. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -
Expression of RNF31 in HCC cell lines and evaluation of RNF31 knockdown. (a) The mRNA level of RNF31 was evaluated in the HepG2, Hep3B, PLC, Huh7, HLE, and HLF cell lines by qPCR. mRNA level of RNF31 in Huh7 cells was used as reference. (b) The protein expression levels of RNF31, RBCK1, and SHARPIN were evaluated by Western blotting. (c) The effect of RNF31 knockdown was evaluated using Western blotting for HepG2, Hep3B, and PLC cells transfected with control (siCont) and RNF31-specific siRNAs (siRNA1-3). For quantification, normalized RNF31/b-actin level in parental cells was used as reference. d. The effect of RNF31 knockdown was evaluated using qPCRs. mRNA level of RNF31/GAPDH in control cells was used as reference. *P < 0.05; ns, non-specific; n.s., not significant; siCont, control siRNA. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RBCK1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
0.04 - 0.4 ug/ml
Reviewed Applications
Read 1 review rated 4 using NBP1-88301 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RBCK1
Alternate Names
C20orf18, EC 6.3.2.-, HBV associated factor 4, HBV-associated factor 4, Heme-oxidized IRP2 ubiquitin ligase 1, Hepatitis B virus X-associated protein 4, HOIL-1, RanBP-type and C3HC4-type zinc finger containing 1, ranBP-type and C3HC4-type zinc finger-containing protein 1, RBCC protein interacting with PKC1, RBCK2, RNF54RING finger protein 54, UBCE7IP3HOIL1, ubiquitin conjugating enzyme 7 interacting protein 3, Ubiquitin-conjugating enzyme 7-interacting protein 3, XAP3, XAP4chromosome 20 open reading frame 18, ZRANB4
Gene Symbol
RBCK1
Additional RBCK1 Products
Product Documents for RBCK1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RBCK1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RBCK1 Antibody - BSA Free
Customer Reviews for RBCK1 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used RBCK1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Bone marrow-derived dendritic cellsSpecies: MouseVerified Customer | Posted 04/28/20175% NFDM in TBS-T was used for blocking, primary and secondary antibody incubations.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...