RhoGDI Antibody (0D6X5)
Novus Biologicals | Catalog # NBP3-15401
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 0D6X5 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565). VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RhoGDI Antibody (0D6X5)
Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401]
Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401] - Western blot analysis of extracts of various cell lines, using RhoGDI Rabbit mAb (NBP3-15401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401]
Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401] - Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (NBP3-15401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Applications for RhoGDI Antibody (0D6X5)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: RhoGDI
Alternate Names
GDIA1, MGC117248, Rho GDI 1, Rho GDP dissociation inhibitor (GDI) alpha, rho GDP-dissociation inhibitor 1, RHOGDI, Rho-GDI alpha, RHOGDI-1
Gene Symbol
ARHGDIA
Additional RhoGDI Products
Product Documents for RhoGDI Antibody (0D6X5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RhoGDI Antibody (0D6X5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for RhoGDI Antibody (0D6X5)
There are currently no reviews for this product. Be the first to review RhoGDI Antibody (0D6X5) and earn rewards!
Have you used RhoGDI Antibody (0D6X5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...