RNF181 Antibody (5A7) - Azide and BSA Free

Novus Biologicals | Catalog # H00051255-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5A7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RNF181 (NP_057578, 90 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT

Reactivity Notes

Human. Other species not tested.

Specificity

LOC51255 - hypothetical protein LOC51255

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for RNF181 Antibody (5A7) - Azide and BSA Free

Western Blot: RNF181 Antibody (5A7) [H00051255-M01]

Western Blot: RNF181 Antibody (5A7) [H00051255-M01]

Western Blot: RNF181 Antibody (5A7) [H00051255-M01] - RNF181 monoclonal antibody (M01), clone 5A7 Analysis of RNF181 expression in Jurkat.
Western Blot: RNF181 Antibody (5A7) [H00051255-M01]

Western Blot: RNF181 Antibody (5A7) [H00051255-M01]

Western Blot: RNF181 Antibody (5A7) [H00051255-M01] - Analysis of RNF181 expression in transfected 293T cell line by RNF181 monoclonal antibody (M01), clone 5A7.Lane 1: RNF181 transfected lysate(17.9 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: RNF181 Antibody (5A7) [H00051255-M01]

Immunoprecipitation: RNF181 Antibody (5A7) [H00051255-M01]

Immunoprecipitation: RNF181 Antibody (5A7) [H00051255-M01] - Analysis of RNF181 transfected lysate using anti-RNF181 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF181 monoclonal antibody.
Sandwich ELISA: RNF181 Antibody (5A7) [H00051255-M01] - Detection limit for recombinant GST tagged RNF181 is approximately 0.1ng/ml as a capture antibody.

Applications for RNF181 Antibody (5A7) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RNF181

RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM]

Alternate Names

E3 ubiquitin-protein ligase RNF181, EC 6.3.2.-, ring finger protein 181HSPC238

Entrez Gene IDs

51255 (Human)

Gene Symbol

RNF181

Additional RNF181 Products

Product Documents for RNF181 Antibody (5A7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF181 Antibody (5A7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF181 Antibody (5A7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RNF181 Antibody (5A7) - Azide and BSA Free and earn rewards!

Have you used RNF181 Antibody (5A7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...