RNPS1 Antibody (7G8) - Azide and BSA Free
Novus Biologicals | Catalog # H00010921-M05
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Western Blot, ELISA, Immunoprecipitation
Cited:
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 7G8
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Specificity
RNPS1 - RNA binding protein S1, serine-rich domain (7G8)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for RNPS1 Antibody (7G8) - Azide and BSA Free
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in rat testis.Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in HeLa.Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in PC-12.Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in 293.Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in Raw 264.7.Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in human kidney.Applications for RNPS1 Antibody (7G8) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in immunprecipitation reported in scientific literature (PMID 22672905)
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: RNPS1
Alternate Names
E5.1, LDC2, MGC117332, RNA binding protein S1, serine-rich domain, RNA-binding protein S1, serine-rich domain, RNA-binding protein with serine-rich domain 1, SR protein, SR-related protein LDC2
Entrez Gene IDs
10921 (Human)
Gene Symbol
RNPS1
UniProt
Additional RNPS1 Products
Product Documents for RNPS1 Antibody (7G8) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RNPS1 Antibody (7G8) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RNPS1 Antibody (7G8) - Azide and BSA Free
Customer Reviews for RNPS1 Antibody (7G8) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review RNPS1 Antibody (7G8) - Azide and BSA Free and earn rewards!
Have you used RNPS1 Antibody (7G8) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Immunoprecipitation Protocol
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...