RPP40 Antibody (1G8) - Azide and BSA Free

Novus Biologicals | Catalog # H00010799-M03

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 1G8

Format

Azide and BSA Free
View all RPP40 Primary Antibodies »

Product Specifications

Immunogen

RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

Specificity

Reacts with ribonuclease P/MRP 40kDa subunit.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for RPP40 Antibody (1G8) - Azide and BSA Free

Western Blot: RPP40 Antibody (1G8) [H00010799-M03]

Western Blot: RPP40 Antibody (1G8) [H00010799-M03]

Western Blot: RPP40 Antibody (1G8) [H00010799-M03] - Analysis of RPP40 expression in transfected 293T cell line by RPP40 monoclonal antibody (M03), clone 1G8. Lane 1: RPP40 transfected lysate (Predicted MW: 28 KDa). Lane 2: Non-transfected lysate.
Sandwich ELISA: RPP40 Antibody (1G8) [H00010799-M03] - Detection limit for recombinant GST tagged RPP40 is 0.1 ng/ml as a capture antibody.

Applications for RPP40 Antibody (1G8) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RPP40

RPP40 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends

Alternate Names

bA428J1.3,40kD subunit, EC 3.1.26.5, ribonuclease P/MRP 40kDa subunit, RNaseP protein p40

Entrez Gene IDs

10799 (Human)

Gene Symbol

RPP40

UniProt

NP_006629 (Human)

Additional RPP40 Products

Product Documents for RPP40 Antibody (1G8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RPP40 Antibody (1G8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPP40 Antibody (1G8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RPP40 Antibody (1G8) - Azide and BSA Free and earn rewards!

Have you used RPP40 Antibody (1G8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies