RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

Novus Biologicals | Catalog # H00011010-M04

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8D9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04]

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04]

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04] - Analysis of GLIPR1 expression in HeLa(Cat # L013V1).
Sandwich ELISA: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04] - Detection limit for recombinant GST tagged GLIPR1 is 0.03 ng/ml as a capture antibody.

Applications for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RTVP-1

The protein encoded by the GLIPR1 gene works as a proapoptic initiator in prostate and bladder cells. Not all variants of the GLIPR1 gene have been documented even though multiple isoforms have been described (isoform 1: 255 AA long, 30 kDA; isoform 2: 237 AA long, nearly 30 kDA). The glioma pathogenesis-related protein 1 provided by the GLIPR1 gene is related to both the pathogenesis-related protein (PR) superfamily as well as the cysteine-rich secretory protein (CRISP) family. GLIPR1 has been research regarding its role in Wilms tumors, neuronitis, prostatitis, leukemia, glioblastoma, astrocytoma where increased expression has been linked with myelomocytic differentiation in macrophage and decreased expression (through gene methylation) has been associated to prostate cancer. The GLIPR1 gene interacts with genes CHD9, NCOA2, NCOA6, CREBBP, and CARM1 to participate in metabolism, expression of GLIPR1 and PPARA activation gene expression.

Long Name

Related to Testis-specific Vespid and Pathogenesis Protein 1

Alternate Names

GLIPR1, RTVP1

Gene Symbol

GLIPR1

Additional RTVP-1 Products

Product Documents for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

Customer Reviews for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free and earn rewards!

Have you used RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...