Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein

Novus Biologicals | Catalog # NBP2-90985

Novus Biologicals
Discontinued Product
NBP2-90985 has been discontinued. View all SARS-CoV-2 Spike S1 products.

Key Product Details

Source

HEK293

Tag

His (C-Term)

Applications

ELISA, Microbial Monitor, SDS-PAGE, Surface Plasmon Resonance (SPR)
Loading...

Product Specifications

Description

A bioactive partial recombinant protein with a His tag at the C-terminus and corresponding to the amino acids sequence of (Val16-Arg685) of the SARS-CoV-2 Spike S1

Source: HEK293

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (Accession #YP_009724390.1)

Purity

>90%, by SDS-PAGE

Endotoxin Level

< 1.0 EU/ug of the protein by LAL method.

Activity

1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Spike S1 at 2 ug/mL (100 uL/well) can bind Recombinant Human ACE2 with a linear range of 0.5-8.7 ng/mL. 2. Immobilized Human ACE2 on COOH Chip can bind SARS-COV-2 Spike S1 with an affinity constant of 11.4 nM as determined in a SPR assay.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein

ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Immobilized Recombinant SARS-COV-2 Spike S1 at 2ug/mL (100 uL/well) can bind Recombinant Human ACE2 with a linear range of 0.5-8.7 ng/mL.
HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - The purity of SARS-COV-2 Spike S1 Protein with His tag (Cat.NBP2-90985) was greater than 95% as determined by SEC-HPLC.
SDS-PAGE: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

SDS-PAGE: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

SDS-Page: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Recombinant SARS-COV-2 Spike S1 Protein with His tag was determined by SDS-PAGE with Coomassie Blue, showing a band at 110-130 kDa.
Surface Plasmon Resonance: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

Surface Plasmon Resonance: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]

Surface Plasmon Resonance: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Immobilized Human ACE2 on COOH Chip, can bind SARS-COV-2 Spike S1 with an affinity constant of 11.4 nM as determined in a SPR assay.

Formulation, Preparation, and Storage

NBP2-90985
Formulation Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Preservative No Preservative
Concentration Lyoph
Reconstitution Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20 to -70C. Avoid freeze-thaw cycles.

Calculators

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Background: SARS-CoV-2 Spike S1

The SARS-CoV-2 Spike protein is one of the four major structural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1,2). The spike protein is the largest of the structural proteins, which also include the membrane (M), envelope (E), and nucleocapsid (N) proteins (1,2). The SARS-CoV-2 spike protein is a 1273 amino acid (aa) heterotrimeric class I fusion protein with each monomer having a theoretical molecular weight of approximately 180 kDa (1). The club-shaped spike protein contains several functional regions and domains including the S1 globular head region which contains the N-terminal receptor-binding domain (RBD) and the S2 stem region that contains the C-terminal fusion domain, two heptad regions, a transmembrane domain, and a cytoplasmic tail (1,2). The viral spike protein is critical for attachment of the virus with the host cell, resulting in fusion and virus entry into the cell (1,2). More specifically, the RBD of the spike protein is responsible for binding to the cell surface receptor angiotensin converting enzyme 2 (ACE2) (1,2). This spike-ACE2 interaction results in a conformational change permitting furin cleavage between the S1 and S2 domains and then cleavage at S2' by TMPRRS2, or another protease, allowing membrane fusion (1,2).

Given the critical role of the spike protein RBD in the interaction with the ACE2 receptor and viral entry, a number of neutralizing antibodies against the RBD have been developed as potential therapeutics for treating COVID-19 (3). These antibodies bind the RBD domain on the S1 subunit inhibiting the interaction with ACE2 (3). However, more studies need to be done as neutralizing antibodies can result in antibody-dependent enhancement, in which the viral entry and replication within the host cell is increased (4). One potential way to combat antibody-dependent enhancement is the use of nanobodies (4). Furthermore, there are currently several vaccine strategies that are in clinical trials, or recently federally approved, that utilize the spike protein in different forms (e.g. full length, S1 RBD, RBD-Fc, N-terminal) for protecting against SARS-CoV-2 infection (4,5). These vaccine strategies include DNA vaccines, viral vector-based vaccines, RNA vaccines, and subunit vaccines (4,5).

References

1. Pillay T. S. (2020). Gene of the month: the 2019-nCoV/SARS-CoV-2 novel coronavirus spike protein. Journal of Clinical Pathology. https://doi.org/10.1136/jclinpath-2020-206658

2. Malik Y. A. (2020). Properties of Coronavirus and SARS-CoV-2. The Malaysian Journal of Pathology.

3. Ho M. (2020). Perspectives on the development of neutralizing antibodies against SARS-CoV-2. Antibody Therapeutics. https://doi.org/10.1093/abt/tbaa009

4. Samrat, S. K., Tharappel, A. M., Li, Z., & Li, H. (2020). Prospect of SARS-CoV-2 spike protein: Potential role in vaccine and therapeutic development. Virus Research. https://doi.org/10.1016/j.virusres.2020.198141

5. Sternberg, A., & Naujokat, C. (2020). Structural features of coronavirus SARS-CoV-2 spike protein: Targets for vaccination. Life Sciences. https://doi.org/10.1016/j.lfs.2020.118056

Alternate Names

SARS-CoV-2

Gene Symbol

S

Additional SARS-CoV-2 Spike S1 Products

Product Documents for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein

Customer Reviews for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein and earn rewards!

Have you used Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...