SLC19A2 Antibody (5B10) - Azide and BSA Free

Novus Biologicals | Catalog # H00010560-M10

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5B10

Format

Azide and BSA Free
View all SLC19A2 Primary Antibodies »

Product Specifications

Immunogen

SLC19A2 (NP_008927.1, 209 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND

Reactivity Notes

Human. Other species not tested.

Specificity

SLC19A2 - solute carrier family 19 (thiamine transporter), member 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SLC19A2 Antibody (5B10) - Azide and BSA Free

Western Blot: SLC19A2 Antibody (5B10) [H00010560-M10]

Western Blot: SLC19A2 Antibody (5B10) [H00010560-M10]

Western Blot: SLC19A2 Antibody (5B10) [H00010560-M10] - Analysis of SLC19A2 expression in A-431 (Cat # L015V1).
ELISA: SLC19A2 Antibody (5B10) [H00010560-M10]

ELISA: SLC19A2 Antibody (5B10) [H00010560-M10]

ELISA: SLC19A2 Antibody (5B10) [H00010560-M10] - Detection limit for recombinant GST tagged SLC19A2 is approximately 0.1ng/ml as a capture antibody.

Applications for SLC19A2 Antibody (5B10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reviewed Applications

Read 1 review rated 3 using H00010560-M10 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SLC19A2

This gene encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness.

Alternate Names

high affinity thiamine transporter, reduced folate carrier protein (RFC) like, solute carrier family 19 (thiamine transporter), member 2, Solute carrier family 19 member 2, TC1, Thiamine carrier 1, thiamine transporter 1, THT1, ThTr1, ThTr-1, THTR1thTr-1, TRMA

Entrez Gene IDs

10560 (Human)

Gene Symbol

SLC19A2

OMIM

249270 (Human)

UniProt

NP_008927.1 (Human)

Additional SLC19A2 Products

Product Documents for SLC19A2 Antibody (5B10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC19A2 Antibody (5B10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC19A2 Antibody (5B10) - Azide and BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used SLC19A2 Antibody (5B10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • SLC19A2 Antibody (5B10)
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human Glioma cells, whole cell lysates
    Species: Human
    Verified Customer | Posted 09/24/2023
    human glioma cell line treated with control, or drug (10 ug each loaded). left lane's top band (between 75-50 kDa) is SLC19A2. Primary Ab: 1/1000 dil in 2% BSA TBST.
    SLC19A2 Antibody (5B10) - Azide and BSA Free H00010560-M10

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies