SLCO2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94572

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLCO2B1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human SLCO2B1 (NP_009187.1). LLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLCO2B1 Antibody - BSA Free

Western Blot: SLCO2B1 AntibodyBSA Free [NBP2-94572]

Western Blot: SLCO2B1 AntibodyBSA Free [NBP2-94572]

Western Blot: SLCO2B1 Antibody [NBP2-94572] - Analysis of extracts of various cell lines, using SLCO2B1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 8s.

Applications for SLCO2B1 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLCO2B1

SLCO2B1 mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost

Alternate Names

OATP2B1OATP-RP2, OATPBDKFZp686E0517, OATP-BKIAA0880, OATPRP2, Organic anion transporter B, Organic anion transporter polypeptide-related protein 2, SLC21A9solute carrier organic anion transporter family member 2B1, solute carrier family 21 (organic anion transporter), member 9, Solute carrier family 21 member 9, solute carrier organic anion transporter family, member 2B1

Gene Symbol

SLCO2B1

Additional SLCO2B1 Products

Product Documents for SLCO2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLCO2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLCO2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLCO2B1 Antibody - BSA Free and earn rewards!

Have you used SLCO2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies