SPATA5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16028

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SPATA5 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 228-304 of human SPATA5 (NP_001304728). LELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SPATA5 Antibody - Azide and BSA Free

Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]

Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]

Western Blot: SPATA5 Antibody [NBP3-16028] - Western blot analysis of extracts of Mouse pancreas, using SPATA5 antibody (NBP3-16028) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]

Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]

Western Blot: SPATA5 Antibody [NBP3-16028] - Western blot analysis of extracts of 293T cells, using SPATA5 antibody (NBP3-16028) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]

Western Blot: SPATA5 AntibodyAzide and BSA Free [NBP3-16028]

Western Blot: SPATA5 Antibody [NBP3-16028] - Western blot analysis of extracts of Rat kidney, using SPATA5 antibody (NBP3-16028) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for SPATA5 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SPATA5

SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis (Bysimilarity)

Alternate Names

AFG2ATPase family gene 2 homolog, ATPase family protein 2 homolog, SPAFspermatogenesis associated factor SPAF, spermatogenesis associated 5, Spermatogenesis-associated factor protein, spermatogenesis-associated protein 5

Gene Symbol

AFG2A

Additional SPATA5 Products

Product Documents for SPATA5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SPATA5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPATA5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SPATA5 Antibody - Azide and BSA Free and earn rewards!

Have you used SPATA5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies