STAM-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85836

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of STAM-1. Peptide sequence: EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for STAM-1 Antibody - BSA Free

Western Blot: STAM-1 Antibody [NBP2-85836]

Western Blot: STAM-1 Antibody [NBP2-85836]

Western Blot: STAM-1 Antibody [NBP2-85836] - WB Suggested Anti-STAM Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellSTAM is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: STAM-1 Antibody [NBP2-85836]

Western Blot: STAM-1 Antibody [NBP2-85836]

Western Blot: STAM-1 Antibody [NBP2-85836] - WB Suggested Anti-STAM Antibody. Positive Control: Lane 1: 20ug mouse brain extract Lane 2: 20ug mouse brain extract. Primary Antibody Dilution : 1:500. Secondary Antibody : Anti rabbit-HRP. Secondry Antibody Dilution : 1:5,000. Submitted by: Scott Wilson, University of Alabama at Birmingham

Applications for STAM-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STAM-1

STAM was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS/HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein.

Long Name

Signal Transducing Adaptor Molecule 1

Alternate Names

HSE1 Homolog, STAM, STAM1

Gene Symbol

STAM

Additional STAM-1 Products

Product Documents for STAM-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STAM-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STAM-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STAM-1 Antibody - BSA Free and earn rewards!

Have you used STAM-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...