Human STEAP2 ELISA Kit (Colorimetric)

Novus Biologicals | Catalog # NBP3-40542

Novus Biologicals
Loading...

Key Product Details

Sample Type & Volume Required Per Well

Tissue homogenates, cell lysates and other biological fluids (100 uL)

Sensitivity

0.062 ng/mL (example only; lot dependent)

Assay Range

0.156 - 10 ng/mL (example only; lot dependent)
Loading...

Product Specifications

Assay Type

Sandwich ELISA

Kit Type

ELISA Kit (Colorimetric)

Species

Human

Description

Assay Length: 4.5 hours

精度

Intra-Assay Precision (Precision within an assay) %CV 10 (example only; lot dependent)

Inter-Assay Precision (Precision between assays) %CV 12 (example only; lot dependent)

Scientific Data Images for Human STEAP2 ELISA Kit (Colorimetric)

Human STEAP2 ELISA Kit (Colorimetric)

ELISA: Human STEAP2 ELISA Kit (Colorimetric) [NBP3-40542]

ELISA: Human STEAP2 ELISA Kit (Colorimetric) [NBP3-40542] - Standard Curve Reference

Kit Contents for Human STEAP2 ELISA Kit (Colorimetric)

  • Detection Reagent A
  • Detection Reagent B
  • Diluent Buffer
  • Instruction manual
  • Plate sealer for 96 wells
  • Pre-coated 96T strip plate
  • Standard
  • Stop Solution
  • TMB Substrate
  • Wash Buffer (30 x concentrate)

Preparation and Storage

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Storage of components varies. See protocol for specific instructions.

Background: STEAP2

STEAP2 is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell cell junctions.

Long Name

Six Transmembrane Epithelial Antigen of the Prostate 2

Alternate Names

IPCA1, PCANAP1, PUMPCn, STAMP1, STMP

Gene Symbol

STEAP2

Additional STEAP2 Products

Product Documents for Human STEAP2 ELISA Kit (Colorimetric)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Human STEAP2 ELISA Kit (Colorimetric)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. ELISA Kits are guaranteed for 6 months from date of receipt.

Related Research Areas

Customer Reviews for Human STEAP2 ELISA Kit (Colorimetric)

There are currently no reviews for this product. Be the first to review Human STEAP2 ELISA Kit (Colorimetric) and earn rewards!

Have you used Human STEAP2 ELISA Kit (Colorimetric)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Human STEAP2 ELISA Kit (Colorimetric)

Showing  1 - 22 FAQs Showing All
  • Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.

    A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

  • Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?

    A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.

  • Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.

    A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

  • Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?

    A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.

Showing  1 - 22 FAQs Showing All
View all FAQs for ELISA Kits
Loading...