Human STEAP2 ELISA Kit (Colorimetric)
Novus Biologicals | Catalog # NBP3-40542
Key Product Details
Sample Type & Volume Required Per Well
Sensitivity
Assay Range
Product Specifications
Assay Type
Kit Type
Species
Description
精度
Intra-Assay Precision (Precision within an assay) %CV 10 (example only; lot dependent)
Inter-Assay Precision (Precision between assays) %CV 12 (example only; lot dependent)
Scientific Data Images for Human STEAP2 ELISA Kit (Colorimetric)
ELISA: Human STEAP2 ELISA Kit (Colorimetric) [NBP3-40542]
ELISA: Human STEAP2 ELISA Kit (Colorimetric) [NBP3-40542] - Standard Curve ReferenceKit Contents for Human STEAP2 ELISA Kit (Colorimetric)
- Detection Reagent A
- Detection Reagent B
- Diluent Buffer
- Instruction manual
- Plate sealer for 96 wells
- Pre-coated 96T strip plate
- Standard
- Stop Solution
- TMB Substrate
- Wash Buffer (30 x concentrate)
Preparation and Storage
Shipping
Stability & Storage
Background: STEAP2
Long Name
Alternate Names
Gene Symbol
Additional STEAP2 Products
Product Documents for Human STEAP2 ELISA Kit (Colorimetric)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Human STEAP2 ELISA Kit (Colorimetric)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. ELISA Kits are guaranteed for 6 months from date of receipt.
Related Research Areas
Customer Reviews for Human STEAP2 ELISA Kit (Colorimetric)
There are currently no reviews for this product. Be the first to review Human STEAP2 ELISA Kit (Colorimetric) and earn rewards!
Have you used Human STEAP2 ELISA Kit (Colorimetric)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Human STEAP2 ELISA Kit (Colorimetric)
-
Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?
A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.
-
Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?
A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.