Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free

Novus Biologicals | Catalog # H00009144-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG3 Kappa Clone # 5C3

Format

Azide and BSA Free
View all Synaptogyrin 2 Primary Antibodies »

Product Specifications

Immunogen

SYNGR2 (NP_004701, 168 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY

Reactivity Notes

Human. Other species not tested.

Specificity

synaptogyrin 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG3 Kappa

Scientific Data Images for Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free

Sandwich ELISA: Synaptogyrin 2 Antibody (5C3) [H00009144-M01] - Detection limit for recombinant GST tagged SYNGR2 is approximately 0.03ng/ml as a capture antibody.

Applications for Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Synaptogyrin 2

This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family.

Alternate Names

Cellugyrin, MGC102914, synaptogyrin 2, synaptogyrin-2

Entrez Gene IDs

9144 (Human)

Gene Symbol

SYNGR2

OMIM

603926 (Human)

UniProt

NP_004701 (Human)

Additional Synaptogyrin 2 Products

Product Documents for Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free and earn rewards!

Have you used Synaptogyrin 2 Antibody (5C3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies