Recombinant Human TAF9b GST (N-Term) Protein

Novus Biologicals | Catalog # H00051616-P01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
View all TAF9b Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-251 of Human TAF9L

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSNKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

53.35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TAF9b GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00051616-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: TAF9b

TAF9L( AAH09566, 1 a.a. - 252 a.a.) recombinant protein with GST.

Alternate Names

31kDa, DN7, DN-7Transcription-associated factor TAFII31L, Neuronal cell death-related protein 7, TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF9Ltranscription associated factor TAFII31L, TAFII31LTBP-associated factor 9L, TFIID-31, transcription initiation factor IID, 31kD subunit, transcription initiation factor TFIID subunit 9B, Transcription initiation factor TFIID subunit 9-like

Gene Symbol

TAF9B

Additional TAF9b Products

Product Documents for Recombinant Human TAF9b GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human TAF9b GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human TAF9b GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human TAF9b GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human TAF9b GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes