TFF3 Antibody (3G11) - Azide and BSA Free

Novus Biologicals | Catalog # H00007033-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3G11

Format

Azide and BSA Free
View all TFF3 Primary Antibodies »

Product Specifications

Immunogen

TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Specificity

TFF3 - trefoil factor 3 (intestinal)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for TFF3 Antibody (3G11) - Azide and BSA Free

Sandwich ELISA: TFF3 Antibody (3G11) [H00007033-M02] - Detection limit for recombinant GST tagged TFF3 is approximately 0.1ng/ml as a capture antibody.

Applications for TFF3 Antibody (3G11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TFF3

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Long Name

Trefoil Factor 3

Alternate Names

ITF, TFI

Entrez Gene IDs

7033 (Human)

Gene Symbol

TFF3

OMIM

600633 (Human)

UniProt

AAH17859 (Human)

Additional TFF3 Products

Product Documents for TFF3 Antibody (3G11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TFF3 Antibody (3G11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Inflammatory Mediators

Citations for TFF3 Antibody (3G11) - Azide and BSA Free

Customer Reviews for TFF3 Antibody (3G11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TFF3 Antibody (3G11) - Azide and BSA Free and earn rewards!

Have you used TFF3 Antibody (3G11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies