TIF1 alpha Antibody (9I0X1)

Novus Biologicals | Catalog # NBP3-33244

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9I0X1
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TIF1 alpha (O15164).

Sequence:
TNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

117 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TIF1 alpha Antibody (9I0X1)

TIF1 alpha Antibody (9I0X1)

Western Blot: TIF1 alpha Antibody (9I0X1) [NBP3-33244] -

Western Blot: TIF1 alpha Antibody (9I0X1) [NBP3-33244] - Western blot analysis of various lysates using TIF1 alpha Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for TIF1 alpha Antibody (9I0X1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIF1 alpha

TIF1 alpha is encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Long Name

Transcription intermediary factor 1-alpha

Alternate Names

RNF82, TIF1, TIF1-alpha, TIF1A, TRIM24

Gene Symbol

TRIM24

Additional TIF1 alpha Products

Product Documents for TIF1 alpha Antibody (9I0X1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIF1 alpha Antibody (9I0X1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIF1 alpha Antibody (9I0X1)

There are currently no reviews for this product. Be the first to review TIF1 alpha Antibody (9I0X1) and earn rewards!

Have you used TIF1 alpha Antibody (9I0X1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...