TIMM44 Antibody (8J1F10)

Novus Biologicals | Catalog # NBP3-33281

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8J1F10
View all TIMM44 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-240 of human TIMM44 (NP_006342.2).

Sequence:
WCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQELAKNKEMKESIKKFRDEARRLEESDVLQEARRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TIMM44 Antibody (8J1F10)

TIMM44 Antibody (8J1F10)

Western Blot: TIMM44 Antibody (8J1F10) [NBP3-33281] -

Western Blot: TIMM44 Antibody (8J1F10) [NBP3-33281] - Western blot analysis of various lysates using TIMM44 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for TIMM44 Antibody (8J1F10)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIMM44

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source

Alternate Names

MIMT44, mitochondrial import inner membrane translocase subunit TIM44, mitochondrial inner membrane translocase, TIM44DKFZp686H05241, translocase of inner mitochondrial membrane 44 homolog (yeast)

Gene Symbol

TIMM44

Additional TIMM44 Products

Product Documents for TIMM44 Antibody (8J1F10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIMM44 Antibody (8J1F10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM44 Antibody (8J1F10)

There are currently no reviews for this product. Be the first to review TIMM44 Antibody (8J1F10) and earn rewards!

Have you used TIMM44 Antibody (8J1F10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies