TLE4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35294

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 173-243 of human TLE4 (NP_001269677).

Sequence:
SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TLE4 Antibody - BSA Free

TLE4 Antibody

Western Blot: TLE4 Antibody [NBP3-35294] -

Western Blot: TLE4 Antibody [NBP3-35294] - Western blot analysis of lysates from Rat lung, using TLE4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for TLE4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TLE4

The Notch signaling pathway controls cellular interactions important for the specification of a variety of fates in both invertebrates and vertebrates. Key players in the Notch pathway are the TLE genes (for transducin-like enhancer of split, also designated ESG for enhancer of split groucho), which are human homologs of the Drosophila groucho gene. Groucho is a transcriptional repressor that plays a key role in neurogenesis, segmentation and sex determination. TLEs associate with chromatin in live cells and specifically with Histone H3, but not with other core histones. Expression of the TLE genes, TLE1, TLE2, TLE3 and TLE4, correlate with immature epithelial cells that are progressing toward a terminally differentiated state, suggesting a role during epithelial differentiation. TLE1, TLE2 and TLE3 have elevated expression in cervial squamous metaplasias and carcinomas, while TLE4 is most highly expressed in the brain, particularly in the caudate nucleus. TLE1 and TLE4 contain SP and WD40 domains, through which TLE1 binds AML1 to inhibit AML1-induced transactivation of the CSF1 receptor. In early stages of cell differentiation, TLE1 is up-regulated, and TLE2 and TLE4 are down-regulated. In later stages, TLE2 and TLE4 are up-regulated, and expression of TLE1 decreases. TLE1 and TLE2 genes map in a tandem array at chromosomal location 19p13.3. The genetic loci for TLE3 and TLE4 are chromosomes 15q22 and 9, respectively.

Alternate Names

BCE1, BCE-1, E(spI), ESG4, homolog of Drosophila E(sp1), KIAA1261, Protein BCE-1, transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila), transducin-like enhancer protein 4

Gene Symbol

TLE4

Additional TLE4 Products

Product Documents for TLE4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TLE4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TLE4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TLE4 Antibody - BSA Free and earn rewards!

Have you used TLE4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...