TRA2B Antibody (7A1) - Azide and BSA Free
Novus Biologicals | Catalog # H00006434-M01
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA, Sandwich ELISA, Knockdown Validated
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 7A1
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
Specificity
SFRS10 (7A1)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for TRA2B Antibody (7A1) - Azide and BSA Free
Western Blot: TRA2B Antibody (7A1) [H00006434-M01]
Western Blot: TRA2B Antibody (7A1) [H00006434-M01] - Analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1.Lane 1: SFRS10 transfected lysate(33.7 KDa).Lane 2: Non-transfected lysate.Western Blot: TRA2B Antibody (7A1) [H00006434-M01]
Western Blot: TRA2B Antibody (7A1) [H00006434-M01] - Analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi ( Cat # H00006434-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody (M01), clone 7A1 (Cat # H00006434-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: TRA2B Antibody (7A1) [H00006434-M01] - Detection limit for recombinant GST tagged SFRS10 is approximately 0.1ng/ml as a capture antibody.
Applications for TRA2B Antibody (7A1) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Knockdown Validated
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: TRA2B
Alternate Names
DKFZp686F18120, hTRA2-beta, SFRS10, Splicing factor, arginine/serine-rich 10, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), SRFS10, TRA-2 beta, TRA2-BETA, TRAN2B, transformer 2 beta homolog (Drosophila), transformer 2 homolog, Transformer-2 protein homolog B, transformer-2 protein homolog beta, transformer-2-beta
Entrez Gene IDs
6434 (Human)
Gene Symbol
TRA2B
OMIM
602719 (Human)
UniProt
Additional TRA2B Products
Product Documents for TRA2B Antibody (7A1) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TRA2B Antibody (7A1) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TRA2B Antibody (7A1) - Azide and BSA Free
Customer Reviews for TRA2B Antibody (7A1) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review TRA2B Antibody (7A1) - Azide and BSA Free and earn rewards!
Have you used TRA2B Antibody (7A1) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...