TRIM5 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35889

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 alpha (NP_149083.2).

Sequence:
EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRIM5 alpha Antibody - BSA Free

TRIM5 alpha Antibody

Western Blot: TRIM5 alpha Antibody [NBP3-35889] -

Western Blot: TRIM5 alpha Antibody [NBP3-35889] - Western blot analysis of various lysates using TRIM5 alpha Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for TRIM5 alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TRIM5 alpha

TRIM5-alpha is a protein that is found in the cells of many mammals and fends of various retrovirus infections. It protects monkeys from infection with HIV-1, and humans from infection with some other viruses. If a retrovirus has entered a cell, it needs to shed its capsid in order to reversely transcribe its genes, so that they can be expressed by the host cell. It is believed that TRIM5 alpha, which is present in the cytoplasm, somehow recognizes the capsid and blocks its shedding, thereby stopping the virus in its tracks. It thus represents an intracellular defense completely separate from the rest of the body's immune system.

Alternate Names

EC 6.3.2, EC 6.3.2.-, RING finger protein 88, RNF88tripartite motif protein TRIM, TRIM5alpha, tripartite motif containing 5, tripartite motif protein TRIM5, tripartite motif-containing 5, tripartite motif-containing protein 5

Gene Symbol

TRIM5

Additional TRIM5 alpha Products

Product Documents for TRIM5 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM5 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM5 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM5 alpha Antibody - BSA Free and earn rewards!

Have you used TRIM5 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...