Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)
Novus Biologicals | Catalog # NBP3-16947
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Human, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6O6T6 expressed in HEK293
Loading...
Product Specifications
Immunogen
A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human Vang-like Protein 2/VANGL2. RDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDC
Modification
p Ser 79, p Ser 82, p Ser 84
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images
Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (5N5B3) [NBP3-16947] - Western blot analysis of extracts of HeLa cells, using Vang-like Protein 2/VANGL2 antibody (NBP3-16947) at 1:1000 dilution.HeLa cells were treated by wnt(100ng/ml) for 30 minutes. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6) [NBP3-16947] -
Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6) [NBP3-16947] - Western blot analysis of various lysates using Vang-like Protein 2/VANGL2 Rabbit mAb at1:1000 dilution. HeLa and C6 cells were treated by wnt(100ng/ml) for 30 minutes.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Applications
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Vang-like Protein 2/VANGL2
Alternate Names
LPP1, LTAP, STB1, STBM, Strabismus, Vang like Protein 2, VANGL2
Gene Symbol
VANGL2
Additional Vang-like Protein 2/VANGL2 Products
Product Documents
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews
There are currently no reviews for this product. Be the first to review Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6) and earn rewards!
Have you used Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...