Wnt-2b Antibody (9M6O7)

Novus Biologicals | Catalog # NBP3-15772

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9M6O7 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Wnt-2b (Q93097). KAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Wnt-2b Antibody (9M6O7)

Western Blot: Wnt-2b Antibody (9M6O7) [NBP3-15772]

Western Blot: Wnt-2b Antibody (9M6O7) [NBP3-15772]

Western Blot: Wnt-2b Antibody (9M6O7) [NBP3-15772] - Western blot analysis of extracts of various cell lines, using Wnt-2b Rabbit mAb (NBP3-15772) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Wnt-2b Antibody (9M6O7)

Application
Recommended Usage

Western Blot

1:500 -1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Wnt-2b

WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternative transcript variants.This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternative transcript variants.

Long Name

Wingless-type MMTV Integration Site Family Member 2b

Alternate Names

Wnt-13, Wnt2b, XWNT2

Gene Symbol

WNT2B

Additional Wnt-2b Products

Product Documents for Wnt-2b Antibody (9M6O7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Wnt-2b Antibody (9M6O7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Wnt-2b Antibody (9M6O7)

There are currently no reviews for this product. Be the first to review Wnt-2b Antibody (9M6O7) and earn rewards!

Have you used Wnt-2b Antibody (9M6O7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies