Zinc finger protein 639 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88632

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Zinc finger protein 639. Peptide sequence: MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Zinc finger protein 639 Antibody - BSA Free

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632] - Hum. Fetal Liver
Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632] - WB Suggested Anti-ZNF639 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle
Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632] - Hum. Fetal Heart
Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632]

Western Blot: Zinc finger protein 639 Antibody [NBP2-88632] - Host: Rabbit. Target Name: ZNF639. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 0.5ug/ml

Applications for Zinc finger protein 639 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Zinc finger protein 639

Zinc finger protein 639 binds DNA and may function as a transcriptional repressor

Alternate Names

ANC_2H01, ZASC1ANC-2H01, zinc finger amplified in esophageal squamous cell carcinomas 1, zinc finger protein 639, Zinc finger protein ANC_2H01, Zinc finger protein ZASC1,6230400O18Rik

Gene Symbol

ZNF639

Additional Zinc finger protein 639 Products

Product Documents for Zinc finger protein 639 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Zinc finger protein 639 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Zinc finger protein 639 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Zinc finger protein 639 Antibody - BSA Free and earn rewards!

Have you used Zinc finger protein 639 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...