ABCA13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57346

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ABCA13 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA13 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ABCA13 Antibody [NBP2-57346]

Immunocytochemistry/ Immunofluorescence: ABCA13 Antibody [NBP2-57346]

Immunocytochemistry/Immunofluorescence: ABCA13 Antibody [NBP2-57346] - Staining of human cell line PC-3 shows localization to nucleoplasm, cytosol & vesicles.

Applications for ABCA13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA13

In human, the ATP-binding cassette (ABC) family of transmembrane transporters has at least 48 genes and 7 genesubfamilies. This gene is a member of ABC gene subfamily A (ABCA). Genes within the ABCA family typically encodeseveral thousand amino acids. Like other ABC transmembrane transporter proteins, this protein has 12 or moretransmembrane alpha-helix domains that likely arrange to form a single central chamber with multiple substrate bindingsites. It is also predicted to have two large extracellular domains and two nucleotide binding domains as is typicalfor ABCA proteins. Alternative splice variants have been described but their biological validity has not beendemonstrated.

Long Name

ATP Binding Cassette Subfamily A Member 13

Alternate Names

ATP binding cassette transporter A13, ATP-binding cassette sub-family A member 13, ATP-binding cassette, sub-family A (ABC1), member 13, DKFZp313D2411, EC 2.7.11.25, EC 3.6.3, FLJ16398, FLJ33876, FLJ33951

Gene Symbol

ABCA13

Additional ABCA13 Products

Product Documents for ABCA13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ABCA13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCA13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCA13 Antibody - BSA Free and earn rewards!

Have you used ABCA13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies