ABCB8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86935

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse ABCB8. Peptide sequence: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ABCB8 Antibody - BSA Free

Western Blot: ABCB8 Antibody [NBP2-86935]

Western Blot: ABCB8 Antibody [NBP2-86935]

Western Blot: ABCB8 Antibody [NBP2-86935] - WB Suggested Anti-Abcb8 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Muscle

Applications for ABCB8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCB8

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, it may involve the compartmentalization and transport of heme, as well as peptides, from the mitochondria to the nucleus and cytosol. This protein may also play a role in the transport of phospholipids into mitochondrial membranes.

Alternate Names

ATP-binding cassette, sub-family B (MDR/TAP), member 8, EC 3.6.3, EST328128, M-ABC1mitochondrial ABC protein, mitochondrial, Mitochondrial ATP-binding cassette 1

Gene Symbol

ABCB8

Additional ABCB8 Products

Product Documents for ABCB8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ABCB8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ABCB8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ABCB8 Antibody - BSA Free and earn rewards!

Have you used ABCB8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...