ACBD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59820

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACBD5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the N terminal of ACBD5. Peptide sequence ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACBD5 Antibody - BSA Free

Western Blot: ACBD5 Antibody [NBP1-59820]

Western Blot: ACBD5 Antibody [NBP1-59820]

Western Blot: ACBD5 Antibody [NBP1-59820] - Human Brain lysate, concentration 0.2-1 ug/ml.
ACBD5 Antibody - BSA Free

Western Blot: ACBD5 Antibody - BSA Free [NBP1-59820] -

The ACBD5/ANKRD26 fusion transcript is translated into a chimeric protein. (A) Representative WB of the ACBD5/ANKRD26 fusion protein. Ctr, lysates from a control individual; Pt, lysates from the patient; Mw, molecular weight markers. (B) Densitometric analysis of ACBD5, ANKRD26, and fused protein expression as Relative Optical density (R.O.D.) normalized versus the actin signal, used as housekeeping. Data in panel B are expressed as mean +/- SD and are representative of five experiments. *, **, ***, and **** indicate a significant difference for p < 0.05, 0.01, 0.001, or 0.0001, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40806462), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ACBD5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACBD5

ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.

Alternate Names

acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor

Gene Symbol

ACBD5

UniProt

Q5T8D3 (Human)

Additional ACBD5 Products

Product Documents for ACBD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACBD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACBD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACBD5 Antibody - BSA Free and earn rewards!

Have you used ACBD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies