ACCN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84381

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACCN1. Peptide sequence: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ACCN1 Antibody - BSA Free (NBP2-84381) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ACCN1 Antibody - BSA Free

Western Blot: ACCN1 Antibody [NBP2-84381]

Western Blot: ACCN1 Antibody [NBP2-84381]

Western Blot: ACCN1 Antibody [NBP2-84381] - WB Suggested Anti-ACCN1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: THP-1 cell lysate

Applications for ACCN1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACCN1

FUNCTION: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate.; SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins. Interacts with STOM. Interacts with PRKCABP and ACCN3.; SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. Note: Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes.

Alternate Names

Acid-sensing ion channel 2, Amiloride-sensitive brain sodium channel, amiloride-sensitive cation channel 1, neuronal, ASIC2a, ASIC2Mammalian degenerin homolog, BNAC1, BNaC1ACCN, BNC1Amiloride-sensitive cation channel neuronal 1, degenerin, hBNaC1, MDEGBrain sodium channel 1, neuronal amiloride-sensitive cation channel 1

Gene Symbol

ASIC2

Additional ACCN1 Products

Product Documents for ACCN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACCN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACCN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACCN1 Antibody - BSA Free and earn rewards!

Have you used ACCN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...