ACF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57308

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACF Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to A1CF(APOBEC1 complementation factor) The peptide sequence was selected from the N terminal of A1CF. Peptide sequence EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACF Antibody - BSA Free

Western Blot: ACF Antibody [NBP1-57308]

Western Blot: ACF Antibody [NBP1-57308]

Western Blot: ACF Antibody [NBP1-57308] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: ACF Antibody [NBP1-57308]

Western Blot: ACF Antibody [NBP1-57308]

Western Blot: ACF Antibody [NBP1-57308] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for ACF Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACF

Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Alternative splicing occurs at this locus and three full-length transcript variants, encoding three distinct isoforms, have been described. Additional splicing has been observed but the full-length nature of these variants has not been determined. [provided by RefSeq]

Alternate Names

ACF65, ACFASPACF64, apo-B RNA editing protein, APOBEC1 complementation factor, apobec-1 complementation factor (ACF) (ASP), APOBEC-1 stimulating protein, APOBEC1CF, APOBEC1-stimulating protein, MGC163391

Gene Symbol

A1CF

UniProt

Q9NQ94 (Human)

Additional ACF Products

Product Documents for ACF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACF Antibody - BSA Free and earn rewards!

Have you used ACF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies