ACTH (1-39)

  ( 1 citations )    
Product Datasheet
Catalog Number:3492
Alternate Names:Adrenocorticotropic hormone (1-39)
Chemical Name:
Product Details
Citations (1)
Supplemental Products
Reviews
Biological Activity
Potent endogenous melanocortin receptor 2 (MC2) agonist (EC50 = 57 pM). Component of the hypothalamic-pituitary-adrenal (HPA) axis that stimulates glucocorticoid production and release from the adrenal cortex. Induces insulin resistance, promotes a proinflammatory profile and stimulates UCP-1 in adipocytes in vitro.
Technical Data
  • M.Wt:
    4541.1
  • Formula:
    C207H308N56O58S
  • Sequence:
    SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    12279-41-3
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for ACTH (1-39) include:

1 Citations: Showing 1 - 1

  1. The atherogenic Scarb1 null mouse model shows a high bone mass phenotype.
    Authors: Martineau Et al.
    Am J Physiol Endocrinol Metab  2014;306:E48

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used ACTH (1-39)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee