ACTH (1-39)

Catalog # Availability Size / Price Qty
3492/1
ACTH (1-39)
1 Image
Description: Potent endogenous MC2 agonist
Alternative Names: Adrenocorticotropic hormone (1-39)
Product Details
Citations (3)
Supplemental Products
Reviews

Biological Activity

Potent endogenous melanocortin receptor 2 (MC2) agonist (EC50 = 57 pM). Component of the hypothalamic-pituitary-adrenal (HPA) axis that stimulates glucocorticoid production and release from the adrenal cortex. Induces insulin resistance, promotes a proinflammatory profile and stimulates UCP-1 in adipocytes in vitro.

Technical Data

M.Wt:
4541.1
Formula:
C207H308N56O58S
Sequence:
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
12279-41-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citations for ACTH (1-39)

The citations listed below are publications that use Tocris products. Selected citations for ACTH (1-39) include:

3 Citations: Showing 1 - 3

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ACTH (1-39)

There are currently no reviews for this product. Be the first to review ACTH (1-39) and earn rewards!

Have you used ACTH (1-39)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.