ACTL6B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86950

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ACTL6B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTL6B. Peptide sequence: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACTL6B Antibody - BSA Free

Western Blot: ACTL6B Antibody [NBP2-86950]

Western Blot: ACTL6B Antibody [NBP2-86950]

Western Blot: ACTL6B Antibody [NBP2-86950] - Host: Rabbit. Target Name: ACTL6A. Sample Type: THP-1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ACTL6B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACTL6B

The protein encoded by the ACTL6B gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. (provided by RefSeq)

Alternate Names

53 kDa BRG1-associated factor B, actin-like 6, actin-like 6B, Actin-related protein Baf53b, ACTL6, ArpNalpha, BAF53Bactin-like protein 6B, BRG1-associated factor 53B, hArpN alpha

Gene Symbol

ACTL6B

Additional ACTL6B Products

Product Documents for ACTL6B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACTL6B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACTL6B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACTL6B Antibody - BSA Free and earn rewards!

Have you used ACTL6B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies