ACTR1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88761

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ACTR1B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTR1B. Peptide sequence: VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACTR1B Antibody - BSA Free

Western Blot: ACTR1B Antibody [NBP2-88761]

Western Blot: ACTR1B Antibody [NBP2-88761]

Western Blot: ACTR1B Antibody [NBP2-88761] - WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 293T cell lysateACTR1B is supported by BioGPS gene expression data to be expressed in HEK293T

Applications for ACTR1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACTR1B

In addition to conventional actins, there are several actin-related proteins. The ACTR1B protein and the ACTR1A protein are of equal length, and they share 90% amino acid identity and 96% amino acid similarity. ACTR1B is expressed in the cytosol as part of the dynactin complex. The dynactin complex has been shown to localize to multiple structures within the cell, including membrane organelles, the centrosome, spindle poles, and spindle pole microtubules during mitosis and prometaphase kinetochores. It regulates dyneinmediated vesicle movement on microtubules as well as spindle assembly and cell division. ACTR1B appears to be ivolved in dynein-driven vesicle movement.

Alternate Names

Actin-related protein 1B, ARP1 (actin-related protein 1, yeast) homolog B (centractin beta), ARP1 actin-related protein 1 homolog B, centractin beta (yeast), ARP1BPC3, centractin beta, CTRN2beta-centractin

Gene Symbol

ACTR1B

Additional ACTR1B Products

Product Documents for ACTR1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACTR1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACTR1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACTR1B Antibody - BSA Free and earn rewards!

Have you used ACTR1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies