ADA2a Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86955

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ADA2a. Peptide sequence: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ADA2a Antibody - BSA Free (NBP2-86955) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ADA2a Antibody - BSA Free

Western Blot: ADA2a Antibody [NBP2-86955]

Western Blot: ADA2a Antibody [NBP2-86955]

Western Blot: ADA2a Antibody [NBP2-86955] - WB Suggested Anti-TADA2L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate.TADA2A is strongly supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: ADA2a Antibody [NBP2-86955]

Western Blot: ADA2a Antibody [NBP2-86955]

Western Blot: ADA2a Antibody [NBP2-86955] - Host: Rabbit. Target Name: TADA2A. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlTADA2A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Applications for ADA2a Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADA2a

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Several alternatively spliced transcript variants encoding different isoforms of this gene have been described, but the full-length nature of some of these variants has not been determined. (provided by RefSeq)

Alternate Names

ADA2AFLJ12705, ADA2-like protein, hADA2, TADA2LADA2, transcriptional adapter 2-alpha, Transcriptional adapter 2-like, transcriptional adaptor 2 (ADA2 homolog, yeast)-like, transcriptional adaptor 2 alpha, transcriptional adaptor 2A

Gene Symbol

TADA2A

Additional ADA2a Products

Product Documents for ADA2a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADA2a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADA2a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADA2a Antibody - BSA Free and earn rewards!

Have you used ADA2a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...