ADAM19 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69367

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADAM19 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19. Peptide sequence GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET. The peptide sequence for this immunogen was taken from within the described region.

Marker

Dendritic Cell Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ADAM19 Antibody - BSA Free

Western Blot: ADAM19 Antibody [NBP1-69367]

Western Blot: ADAM19 Antibody [NBP1-69367]

Western Blot: ADAM19 Antibody [NBP1-69367] - This Anti-ADAM19 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Applications for ADAM19 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAM19

ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.

Long Name

A Disintegrin and Metalloprotease-like Domain 19

Alternate Names

Meltrin beta

Gene Symbol

ADAM19

UniProt

Q9H013

Additional ADAM19 Products

Product Documents for ADAM19 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAM19 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Citations for ADAM19 Antibody - BSA Free

Customer Reviews for ADAM19 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAM19 Antibody - BSA Free and earn rewards!

Have you used ADAM19 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies