ADCY4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82567

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Adenylate Cyclase 4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ADCY4. Peptide sequence: IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ADCY4 Antibody - BSA Free (NBP2-82567) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ADCY4 Antibody - BSA Free

Western Blot: ADCY4 Antibody [NBP2-82567]

Western Blot: ADCY4 Antibody [NBP2-82567]

Western Blot: ADCY4 Antibody [NBP2-82567] - Host: Rabbit. Target Name: ADCY4. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for ADCY4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenylate Cyclase 4

Adenylyl cyclases function to convert ATP to cyclic AMP in response to activation by a variety of hormones, neurotransmitters and other regulatory molecules. Cyclic AMP, in turn, activates several other target molecules to control a broad range of diverse phenomena such as metabolism, gene transcription and memory. Adenylyl cyclases respond to receptor-initiated signals, mediated by the Gs and Gi heterotrimeric G proteins. The binding of an agonist to a Gs-coupled receptor catalyzes the exchange of GDP (bound to Galpha s) for GTP, the dissociation of GTP-Galpha s from Gbetagamma and Galpha s-mediated activation of adenylyl cyclase. Adenylyl cyclase IV (AC IV) and IX mRNA are expressed in all kidney nephron segments. AC IV exhibits moderate staining in type II and type IV fibrocytes in rat cochlea and immunoreactivity is also observed in type I fibrocytes. Activation of the D2 dopaminergic and m4 muscarine receptors inhibits the activity of adenylyl cyclase isozymes I, V, VI and VIII, whereas type II, IV and VII are stimulated and type III is not affected.

Long Name

Adenylate cyclase type 4

Alternate Names

ADCY4, Adenylyl cyclase 4

Gene Symbol

ADCY4

Additional Adenylate Cyclase 4 Products

Product Documents for ADCY4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADCY4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADCY4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADCY4 Antibody - BSA Free and earn rewards!

Have you used ADCY4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies