ADTB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86958

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ADTB1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADTB1. Peptide sequence: PSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ADTB1 Antibody - BSA Free

Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958] - Host: Rabbit. Target Name: AP1B1. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958] - Host: Mouse. Target Name: AP1B1. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

Applications for ADTB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADTB1

Membrane vesicle formation is a process required for the endocytosis and biosynthesis of various secreted and membrane bound proteins. Clathrin is a protein which assembles into a polyhedral network on the cell membrane as the membrane invaginates, forming a coated pit which is essential to endocytosis. Clathrin is composed of three polypeptides, a 180 kDa heavy chain and two 32-38 kDa light chains which combine to create a distinct three-legged triskelion. It is this morphology which allows Clathrin to form its unique polyhedral network.

Alternate Names

Adapter-Related Protein Complex 1 Subunit Beta-1, Adaptor Protein Complex AP-1 Subunit Beta-1, Adaptor-Related Protein Complex 1, Beta 1 Subunit, AP-1 Complex Subunit Beta-1, AP105A, AP1B1, BAM22, Beta-1-adaptin, beta1-adaptin, Beta-Adaptin 1, beta-prime-adaptin, CLAPB2, Clathrin Assembly Protein Complex 1 Beta Large Chain, Golgi Adaptor HA1/AP1 Adaptin Beta Subunit, Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit

Gene Symbol

AP1B1

Additional ADTB1 Products

Product Documents for ADTB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADTB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADTB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADTB1 Antibody - BSA Free and earn rewards!

Have you used ADTB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies