AE2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59858
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Rat
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Use in Rat reported in scientific literature (PMID:34897412).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
137 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for AE2 Antibody - BSA Free
Western Blot: AE2 Antibody [NBP1-59858]
Western Blot: AE2 Antibody [NBP1-59858]Western Blot: AE2 Antibody - BSA Free [NBP1-59858] -
Inhibition of induction of carbonic anhydrase II (CAII), anion exchange protein 2 (Ae2), chloride channel 7 (ClC-7), vacuolar-type H(+)-ATPase (V-ATPase), and cathapsin K (A,B), matrix metalloproteinase 9 (MMP-9) secretion (C), and bone resorption (D) by aesculetin. Raw 264.7 cells were cultured in minimum essential medium alpha medium ( alpha -MEM) with 50 ng/mL receptor activator of nuclear factor-kappa B ligand (RANKL) in the absence or presence of 1–10 μM aesculetin for 5 days. Whole-cell lysates were subject to SDS-PAGE and Western blot with a specific antibody against CAII, Ae2, ClC-7 V-ATPase, and cathapsin K (A,B). An equal volume of culture medium was subject to sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) and Western blot with a specific antibody against MMP-9 (C). beta -Actin was used as internal control. The bar graphs (mean +/- SEM, n = 3) represent quantitative results of blots obtained from a densitometer. Respective values in double-bar graphs not sharing a small letter are significantly different at p < 0.05. The osteoclast bone resorption was assayed using a commercially available bone resorption assay kit ((D), three separate experiments). Attached cells were removed, and resorption pits on the plate were visualized under light microscopy. Scale bar = 20 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33203061), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for AE2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: AE2
Alternate Names
AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1)
Entrez Gene IDs
6522 (Human)
Gene Symbol
SLC4A2
UniProt
Additional AE2 Products
Product Documents for AE2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AE2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for AE2 Antibody - BSA Free
Customer Reviews for AE2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review AE2 Antibody - BSA Free and earn rewards!
Have you used AE2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...