AE2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59858

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Rat

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Rat reported in scientific literature (PMID:34897412).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

137 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AE2 Antibody - BSA Free

Western Blot: AE2 Antibody [NBP1-59858]

Western Blot: AE2 Antibody [NBP1-59858]

Western Blot: AE2 Antibody [NBP1-59858]
AE2 Antibody - BSA Free

Western Blot: AE2 Antibody - BSA Free [NBP1-59858] -

Inhibition of induction of carbonic anhydrase II (CAII), anion exchange protein 2 (Ae2), chloride channel 7 (ClC-7), vacuolar-type H(+)-ATPase (V-ATPase), and cathapsin K (A,B), matrix metalloproteinase 9 (MMP-9) secretion (C), and bone resorption (D) by aesculetin. Raw 264.7 cells were cultured in minimum essential medium alpha medium ( alpha -MEM) with 50 ng/mL receptor activator of nuclear factor-kappa B ligand (RANKL) in the absence or presence of 1–10 μM aesculetin for 5 days. Whole-cell lysates were subject to SDS-PAGE and Western blot with a specific antibody against CAII, Ae2, ClC-7 V-ATPase, and cathapsin K (A,B). An equal volume of culture medium was subject to sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) and Western blot with a specific antibody against MMP-9 (C). beta -Actin was used as internal control. The bar graphs (mean +/- SEM, n = 3) represent quantitative results of blots obtained from a densitometer. Respective values in double-bar graphs not sharing a small letter are significantly different at p < 0.05. The osteoclast bone resorption was assayed using a commercially available bone resorption assay kit ((D), three separate experiments). Attached cells were removed, and resorption pits on the plate were visualized under light microscopy. Scale bar = 20 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33203061), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for AE2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AE2

SLC4A2 is a plasma membrane anion exchange protein of wide distribution.

Alternate Names

AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1)

Entrez Gene IDs

6522 (Human)

Gene Symbol

SLC4A2

UniProt

Additional AE2 Products

Product Documents for AE2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AE2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for AE2 Antibody - BSA Free

Customer Reviews for AE2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AE2 Antibody - BSA Free and earn rewards!

Have you used AE2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...