AGFG2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82584

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AGFG2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human AGFG2. Peptide sequence: NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for AGFG2 Antibody - BSA Free

Western Blot: AGFG2 Antibody [NBP2-82584]

Western Blot: AGFG2 Antibody [NBP2-82584]

Western Blot: AGFG2 Antibody [NBP2-82584] - Host: Rabbit. Target Name: AGFG2. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for AGFG2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AGFG2

AGFG2 codes for a protein is 481 amino acids long and weighs approximately 49 kDa, with a short isoform with a length of 156 amino acids and a weight of approximately 17 kDa. AGFG2 codes for a protein that helps control the necleocytoplasmic transfer of proteins and RNAs, which is a process known as the Rev export pathway. Current studies are being done on several diseases and disorders relating to this gene, including xerophthalmia and bronchiectasis. AGFG2 has also been shown to have interactions with EPS15L1, EPS15, and ITSN1.

Alternate Names

ArfGAP with FG repeats 2, HIV-1 Rev binding protein-like, HIV-1 Rev-binding protein-like protein, HRBLnucleoporin, RAB-R, RABRarf-GAP domain and FG repeats-containing protein 2, Rev/Rex activation domain binding protein-related, Rev/Rex activation domain-binding protein related

Gene Symbol

AGFG2

Additional AGFG2 Products

Product Documents for AGFG2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AGFG2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AGFG2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AGFG2 Antibody - BSA Free and earn rewards!

Have you used AGFG2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies