AKAP10 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-56509
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133).
Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for AKAP10 Antibody - BSA Free
Western Blot: AKAP10 Antibody [NBP1-56509]
Western Blot: AKAP10 Antibody [NBP1-56509] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.Western Blot: AKAP10 Antibody [NBP1-56509]
Western Blot: AKAP10 Antibody [NBP1-56509] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T.Applications for AKAP10 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: AKAP10
Alternate Names
A kinase (PRKA) anchor protein 10, AKAP-10, A-kinase anchor protein 10, mitochondrial, D-AKAP2, D-AKAP-2, Dual specificity A kinase-anchoring protein 2, dual-specificity A-kinase anchoring protein 2, MGC9414, mitochondrial A kinase PPKA anchor protein 10, PRKA10a kinase anchor protein 10, mitochondrial, protein kinase A anchoring protein 10, Protein kinase A-anchoring protein 10
Entrez Gene IDs
11216 (Human)
Gene Symbol
AKAP10
UniProt
Additional AKAP10 Products
Product Documents for AKAP10 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AKAP10 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for AKAP10 Antibody - BSA Free
Customer Reviews for AKAP10 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review AKAP10 Antibody - BSA Free and earn rewards!
Have you used AKAP10 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...