AKAP10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56509

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AKAP10 Antibody - BSA Free

Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T.

Applications for AKAP10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKAP10

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Alternate Names

A kinase (PRKA) anchor protein 10, AKAP-10, A-kinase anchor protein 10, mitochondrial, D-AKAP2, D-AKAP-2, Dual specificity A kinase-anchoring protein 2, dual-specificity A-kinase anchoring protein 2, MGC9414, mitochondrial A kinase PPKA anchor protein 10, PRKA10a kinase anchor protein 10, mitochondrial, protein kinase A anchoring protein 10, Protein kinase A-anchoring protein 10

Entrez Gene IDs

11216 (Human)

Gene Symbol

AKAP10

UniProt

Additional AKAP10 Products

Product Documents for AKAP10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKAP10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for AKAP10 Antibody - BSA Free

Customer Reviews for AKAP10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKAP10 Antibody - BSA Free and earn rewards!

Have you used AKAP10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...