AKAP3 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25270PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all AKAP3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP3

Source: E.coli

Amino Acid Sequence: FSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25270It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25270PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AKAP3

A-kinase anchor proteins (AKAPs) direct the activity of protein kinase A (PKA) by tethering the enzyme near its physiologic substrates. May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction in sperm.

Alternate Names

A kinase (PRKA) anchor protein 3, AKAP110AKAP 110, AKAP-3, A-kinase anchor protein 110 kDa, Cancer/testis antigen 82, CT82A-kinase anchor protein 3, Fibrous sheath protein of 95 kDa, fibrousheathin 1, Fibrousheathin I, fibrousheathin-1, FSP95A-kinase anchor protein, 110kDa, PRKA3, protein kinase A anchoring protein 3, Protein kinase A-anchoring protein 3, SOB1fibrous sheath protein, 95kDa, Sperm oocyte-binding protein, sperm oocyte-binding protein 1

Gene Symbol

AKAP3

Additional AKAP3 Products

Product Documents for AKAP3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKAP3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for AKAP3 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review AKAP3 Recombinant Protein Antigen and earn rewards!

Have you used AKAP3 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes