AKT1/2/3 Inhibitor Peptide Set

Novus Biologicals | Catalog # NBP2-29332

Novus Biologicals
100% Guarantee

Key Product Details

Species

Human

Product Specifications

Specificity

The Akt (Isoforms 1,2,3) inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.

The control peptide consists of only the PTD sequence.

Application Notes

Inhibition of Akt kinase activity.
The inhibitor peptide is to block Akt1, Akt2, and Akt3 kinase activity. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.

Please refer to Hiromura et al (2004) for additional information about how the inhibitor peptide has been used to block Ak1, Akt2 and Akt3 kinase activity.

Inhibitor Content

Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361

Formulation, Preparation, and Storage

Preparation Method

Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions.
Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. Akt (Isoforms 1,2,3) Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF Add 47.6 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.

Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving

Please contact technical support for detailed reconstitution instructions.

Formulation

Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).

Concentration

Lyoph

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: AKT1/2/3

Akt is a protein kinase that plays a central role in inhibiting apoptosis through promoting cell survival. Activated Akt functions by phosphorylating downstream targets in survival signaling pathways. TCL1 (a proto-oncogene underlying human T cell prolymphocytic leukemia) interacts with Akt through an Nterminal pleckstrin homology (PH) domain and functions as an Akt kinase co-activator. This inhibitory peptide contains a sequence (AVTDHPDRLWAWEKF) corresponding to the A strand of human TCL1 that interacts with Akt. 1 The peptide binds to the PH domain of Akt and inhibits Akt1, Akt2, and Akt3 kinase activity.

Alternate Names

AKT, EC 2.7.11, EC 2.7.11.1, PKBMGC99656, PRKBA, Protein kinase B, Proto-oncogene c-Akt, rac protein kinase alpha, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha, RACPKB-ALPHA, v-akt murine thymoma viral oncogene homolog 1

Gene Symbol

AKT1

Additional AKT1/2/3 Products

Product Documents for AKT1/2/3 Inhibitor Peptide Set

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKT1/2/3 Inhibitor Peptide Set

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Citations for AKT1/2/3 Inhibitor Peptide Set

Customer Reviews for AKT1/2/3 Inhibitor Peptide Set (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used AKT1/2/3 Inhibitor Peptide Set?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Ronald Miller
    Application: Western Blot
    Sample Tested: Cell lysate from HeLa cells
    Species: Human
    Verified Customer | Posted 12/12/2014
    Western blot for HeLa cells
    AKT1/2/3 Inhibitor Peptide Set NBP2-29332

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

View specific protocols for AKT1/2/3 Inhibitor Peptide Set (NBP2-29332):

AKT1/2/3 Inhibitor Peptide Set:
Hazard Information
Chemical Name: Non hazardous products
Chemical Formula: N/A
CAS Number: N/A
EEC-No: N/A

Hazard Identification
None
First Aid Measures
Eye Contact: None
Skin Contact: None
Inhalation: None
Ingestion: None

Accidental Release Measures
This product either does not contain hazardous constituents or the concentration of all chemical constituents are below the regulatory threshold limits described by Occupational Safety Health Administration Hazard Communication Standard 29 CFR 1910.1200 and the European Directive 91/155/EEC. 88/379/EEC, and 67/546/EEC.

Handling and Storage
Exposure Controls / Personal Protection
Other Precautions: None

Physical and Chemical Properties
Form: N/A
Color: N/A
Odor: N/A
Melting Point: N/A
Boiling Temperature: N/A
Density: N/A
Vapor Pressure: N/A
Solubility in Water: N/A
Flash Point: N/A
Explosion limits: N/A
Ignition Temperature: N/A