Alix Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25272

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Alix Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Alix using the following amino acid sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Alix Antibody - BSA Free

Alix Antibody Immunohistochemistry-Paraffin: Alix Antibody [NBP3-25272]

Immunohistochemistry-Paraffin: Alix Antibody [NBP3-25272]

Staining of human small intestine shows cytoplasmic positivity in glandular cells.
Alix Antibody Western Blot: Alix Antibody [NBP3-25272]

Western Blot: Alix Antibody [NBP3-25272]

Analysis in human cell line RT-4 and human cell line U-251 MG.

Applications for Alix Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Alix

Alix encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death.

Alternate Names

AIP1DRIP4, ALG-2 interacting protein 1, ALG-2 interacting protein X, ALG-2-interacting protein 1, alinx, ALIX, apoptosis-linked gene 2-interacting protein X, dopamine receptor interacting protein 4, HP95, KIAA1375, MGC17003, PDCD6-interacting protein, programmed cell death 6 interacting protein, programmed cell death 6-interacting protein

Gene Symbol

PDCD6IP

Additional Alix Products

Product Documents for Alix Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Alix Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Alix Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Alix Antibody - BSA Free and earn rewards!

Have you used Alix Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies