Alkaline Phosphatase/ALPP Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-34056PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: NWYSDADVPASARQEGCQDIATQLISNMDI
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-34056PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Alkaline Phosphatase/ALPP
Long Name
Alternate Names
Gene Symbol
Additional Alkaline Phosphatase/ALPP Products
Product Documents for Alkaline Phosphatase/ALPP Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Alkaline Phosphatase/ALPP Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Alkaline Phosphatase/ALPP Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review Alkaline Phosphatase/ALPP Recombinant Protein Antigen and earn rewards!
Have you used Alkaline Phosphatase/ALPP Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for Alkaline Phosphatase/ALPP Recombinant Protein Antigen
-
Q: I am looking to use a placental alkaline phosphatase antibody for sorting syncytiotrophoblast material from female tissue. It looks like most people who use these antibodies use in-house versions and references for commercially available antibodies I've found are from the '80's. I noticed you have several different monoclonal antibodies and was hoping you could give me a little more information on them and potential applications they've been tested for. Also, do you have a biotinylated or fluorophore-conjugated version?
A: None of our placental alkaline phosphatase antibodies are biotinylated or fluorchrome conjugated but we offer a number of kits for this application and our lab can do a custom conjugation as well, for an additional fee. NB600-750 is useful in FACS with human cells, so I would recommend this antibody for your experiment. We back the use of this antibody as stated on the datasheet with the 100% Novus Guarantee. If you have questions about another antibody, I will be happy to answer them.