Aly Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10855

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Aly Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse REFBP2 (NP_062357.3). Peptide sequence KMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aly Antibody - BSA Free

Western Blot: Aly Antibody [NBP3-10855]

Western Blot: Aly Antibody [NBP3-10855]

Western Blot: Aly Antibody [NBP3-10855] - Western blot analysis of Aly in Mouse Pancreas lysates. Antibody dilution at 1ug/ml

Applications for Aly Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aly

Pre-mRNA splicing plays an important role in regulation of gene expression. During the splicing process, specific proteins are recruited to the mRNA and assembled into a complex of mRNA-protein near the exon-exon junction. This complex is termed the mRNA-protein complex (mRNP) or the exon-exon junction complex. The proteins that are found in this complex include: Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK.1-5 Aly (also known as mREF1-I) is the mammalian homologue of the yeast mRNA export factor Yra1p.6-7 It is a 233 amino acid RNAbinding protein that contains a RNA-binding domain and is recruited to the mRNP complexes during the splicing. Excess of recombinant expression of Aly in the cells increases both the rate and efficiency of spliced and unspliced mRNA export (in vivo) from the nucleus to the cytoplasm. In contrast to the Y14 protein, Aly is dissociated from the mRNAs after the export to the cytoplasm.1, 5-6

Alternate Names

Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, Tho4, Transcriptional coactivator Aly/REF

Gene Symbol

ALYREF

Additional Aly Products

Product Documents for Aly Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aly Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aly Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aly Antibody - BSA Free and earn rewards!

Have you used Aly Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies