AMFR/gp78 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25274PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all AMFR/gp78 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMFR/gp78

Source: E.coli

Amino Acid Sequence: VQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25274It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25274PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AMFR/gp78

AMFR (Autocrine motility factor receptor, isoform 2) is specific receptor for the autocrine motility factor. AMFR possesses ubiquitin ligase activity and can target both itself and other proteins including CD3D and APOB for proteasomal degradation. AMFR mediates tumor invasion and metastasis. The protein interacts with UBE2G2/UBC7 through a region distinct from the RING finger.

Long Name

Autocrine Motility Factor Receptor

Alternate Names

gp78, RNF45

Gene Symbol

AMFR

Additional AMFR/gp78 Products

Product Documents for AMFR/gp78 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AMFR/gp78 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
E3 Ubiquitin Ligases

Customer Reviews for AMFR/gp78 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review AMFR/gp78 Recombinant Protein Antigen and earn rewards!

Have you used AMFR/gp78 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes