AP1M2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57035

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AP1M2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AP1M2 (adaptor-related protein complex 1, mu 2 subunit) The peptide sequence was selected from the N terminal of AP1M2 (NP_005489). Peptide sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: mu-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AP1M2 Antibody - BSA Free

Western Blot: AP1M2 Antibody [NBP1-57035]

Western Blot: AP1M2 Antibody [NBP1-57035]

Western Blot: AP1M2 Antibody [NBP1-57035] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml AP1M2 is strongly supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: AP1M2 Antibody [NBP1-57035]

Western Blot: AP1M2 Antibody [NBP1-57035]

Western Blot: AP1M2 Antibody [NBP1-57035] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for AP1M2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP1M2

This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.

Alternate Names

Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2

Entrez Gene IDs

10053 (Human)

Gene Symbol

AP1M2

UniProt

Q9Y6Q5 (Human)

Additional AP1M2 Products

Product Documents for AP1M2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AP1M2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AP1M2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AP1M2 Antibody - BSA Free and earn rewards!

Have you used AP1M2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies