APBB3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10783

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human APBB3. Peptide sequence AQTRSRSQPPDGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for APBB3 Antibody - BSA Free

Western Blot: APBB3 Antibody [NBP3-10783]

Western Blot: APBB3 Antibody [NBP3-10783]

Western Blot: APBB3 Antibody [NBP3-10783] - Western blot analysis of APBB3 in Human 293T Whole Cell. Antibody dilution at 1 ug/mL

Applications for APBB3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APBB3

APBB3 is encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

amyloid beta (A4) precursor protein-binding, family B, member 3, amyloid precursor interacting protein, Fe65L2, FE65L2amyloid beta A4 precursor protein-binding family B member 3, FE65-like protein 2, MGC150555, MGC87674, Protein Fe65-like 2, SRA

Gene Symbol

APBB3

Additional APBB3 Products

Product Documents for APBB3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for APBB3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APBB3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review APBB3 Antibody - BSA Free and earn rewards!

Have you used APBB3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...