Apc7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10655

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Apc7 (NP_001100612). Peptide sequence NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Apc7 Antibody - BSA Free

Western Blot: Apc7 Antibody [NBP3-10655]

Western Blot: Apc7 Antibody [NBP3-10655]

Western Blot: Apc7 Antibody [NBP3-10655] - Western blot analysis of Apc7 in Rat Stomach lysates. Antibody dilution at 1.0ug/ml

Applications for Apc7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apc7

APC7 (anaphase-promoting complex subunit 7) is a member of the E3 enzyme family. This protein contains TPR repeats and has a molecular weight of approximately 63 kD. The APC7 protein is located in the nucleus during interphase and the centrosome during metaphase/anaphase. This protein probably recruits Cdh1 into the APC complex. The APC7 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC7 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. The Poly6113 antibody has been shown to be useful for Western blotting of the human APC7 protein.

Alternate Names

anaphase promoting complex subunit 7, anaphase-promoting complex subunit 7, APC7Cyclosome subunit 7

Gene Symbol

ANAPC7

Additional Apc7 Products

Product Documents for Apc7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apc7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Apc7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apc7 Antibody - BSA Free and earn rewards!

Have you used Apc7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...