Biological Activity
Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.Technical Data
M.Wt:
4195.87
Formula:
C184H297N69O43S
Sequence:
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
252642-12-9
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Apelin peptides block the entry of human immunodeficiency virus (HIV).
Zou et al.
FEBS Lett., 2000;473:15 -
Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin.
Medhurst et al.
J.Neurochem., 2003;84:1162 -
Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.
Tatemoto et al.
Biochem.Biophys.Res.Comms., 1998;251:471
Product Datasheets
Or select another batch:
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsVersaClone cDNA Plasmids
Reviews for Apelin-36 (human)
There are currently no reviews for this product. Be the first to review Apelin-36 (human) and earn rewards!
Have you used Apelin-36 (human)?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.