Catalog Number: 2426
Biological Activity
Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.
Technical Data
  • M.Wt:
    4195.87
  • Formula:
    C184H297N69O43S
  • Sequence:
    LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    252642-12-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Apelin peptides block the entry of human immunodeficiency virus (HIV).
    Zou et al.
    FEBS Lett., 2000;473:15
  2. Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin.
    Medhurst et al.
    J.Neurochem., 2003;84:1162
  3. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.
    Tatemoto et al.
    Biochem.Biophys.Res.Comm., 1998;251:471

Have you used Apelin-36 (human)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information