ARF1 Antibody (0C5B3)

Novus Biologicals | Catalog # NBP3-16782

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0C5B3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ARF1 (P84077). GQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARF1 Antibody (0C5B3)

Western Blot: ARF1 Antibody (0C5B3) [NBP3-16782]

Western Blot: ARF1 Antibody (0C5B3) [NBP3-16782]

Western Blot: ARF1 Antibody (0C5B3) [NBP3-16782] - Western blot analysis of extracts of various cell lines, using ARF1 Rabbit mAb (NBP3-16782) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
ARF1 Antibody (0C5B3)

Immunocytochemistry/ Immunofluorescence: ARF1 Antibody (0C5B3) [NBP3-16782] -

Immunocytochemistry/ Immunofluorescence: ARF1 Antibody (0C5B3) [NBP3-16782] - Immunofluorescence analysis of NIH-3T3 cells using ARF1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for ARF1 Antibody (0C5B3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARF1

The ADP-ribosylation factor (Arf) family comprises a group of structurally and functionally conserved 21 kDa proteins, which are members of the Ras superfamily of regulatory GTP-binding proteins. Arf is involved in intracellular protein traffic to and within the Golgi complex. Arf has a number of disparate activities including maintenance of organelle integrity, assembly of coat proteins, as a co-factor for cholera toxin and as an activator of phospholipase D. The Arf family is divided functionally into the Arf and the Arf-like (Arl) proteins. Arfs share more than 60% sequence identity, appear to be ubiquitous in eukaryotes, and are highly conserved evolutionarily.

Long Name

ADP-ribosylation factor 1

Alternate Names

ADP-ribosylation factor 1

Gene Symbol

ARF1

Additional ARF1 Products

Product Documents for ARF1 Antibody (0C5B3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARF1 Antibody (0C5B3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARF1 Antibody (0C5B3)

There are currently no reviews for this product. Be the first to review ARF1 Antibody (0C5B3) and earn rewards!

Have you used ARF1 Antibody (0C5B3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...