ARF6 Antibody (9E7T9)

Novus Biologicals | Catalog # NBP3-15391

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9E7T9 expressed in HEK293
View all ARF6 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330). HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARF6 Antibody (9E7T9)

Western Blot: ARF6 Antibody (9E7T9) [NBP3-15391]

Western Blot: ARF6 Antibody (9E7T9) [NBP3-15391]

Western Blot: ARF6 Antibody (9E7T9) [NBP3-15391] - Western blot analysis of extracts of various cell lines, using ARF6 Rabbit mAb (NBP3-15391) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: ARF6 Antibody (9E7T9) [NBP3-15391]

Immunocytochemistry/ Immunofluorescence: ARF6 Antibody (9E7T9) [NBP3-15391]

Immunocytochemistry/Immunofluorescence: ARF6 Antibody (9E7T9) [NBP3-15391] - Immunofluorescence analysis of C6 cells using ARF6 Rabbit mAb (NBP3-15391) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: ARF6 Antibody (9E7T9) [NBP3-15391]

Western Blot: ARF6 Antibody (9E7T9) [NBP3-15391]

Western Blot: ARF6 Antibody (9E7T9) [NBP3-15391] - Western blot analysis of extracts of various cell lines, using ARF6 Rabbit mAb (NBP3-15391) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
ARF6 Antibody (9E7T9)

Immunocytochemistry/ Immunofluorescence: ARF6 Antibody (9E7T9) [ARF6] -

Immunocytochemistry/ Immunofluorescence: ARF6 Antibody (9E7T9) [ARF6] - Immunofluorescence analysis of C6 cells using ARF6 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ARF6 Antibody (9E7T9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARF6

The ARF6 gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encodesmall guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and playa role in vesicular tr

Long Name

ADP-ribosylation factor 6

Alternate Names

EC 3.6.5.2

Gene Symbol

ARF6

Additional ARF6 Products

Product Documents for ARF6 Antibody (9E7T9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARF6 Antibody (9E7T9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARF6 Antibody (9E7T9)

Customer Reviews for ARF6 Antibody (9E7T9)

There are currently no reviews for this product. Be the first to review ARF6 Antibody (9E7T9) and earn rewards!

Have you used ARF6 Antibody (9E7T9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARF6 Antibody (9E7T9)

Showing  1 - 2 of 2 FAQs Showing All

  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies